PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0753s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 492aa    MW: 53733.2 Da    PI: 7.1068
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0753s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-39100159261
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                             ++k+++cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  SapurV1A.0753s0070.2.p 100 PDKIVPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGSMRNVPIGAGRRKNKHL 159
                             7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3092157IPR003851Zinc finger, Dof-type
PfamPF027011.7E-31102158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MKGESKDPAF KLFGRMISVP DARFPAEPLA KGSCSEITRV ETKGPSEDNS EEPEMFSVSG  60
QGKEESQAAM RVNEAQVIAK PKEGPLETND TDQEKVLKKP DKIVPCPRCN SLDTKFCYFN  120
NYNVNQPRHF CKNCQRYWTA GGSMRNVPIG AGRRKNKHLA TQYRQILVSS DGMPISGMEN  180
SDSISHQLQS SVESASTLSP STENGMVLKF GHETPRYDSM ENVLNLGDQN RYVEISSVNR  240
QDNVEEPSSC GSSKTASTAW ANELRENIMQ KERVDLPASS NELNAPNSLP CYSVPSWVFP  300
WNPAWNNVSS MAASQYSTGQ ARVTNIPNQV QLCPTPMLTV PSICPPNIPL QFVPSSYWGC  360
MPAWAAGTRN VSLSGSNVCL SPSTATSTSC CSGNGSPTLG KHSRDSKFMD EEKAGRRILV  420
PKTLRIDDPS EASKSPLWAA LGLQKDPSSK GTIFKNFETK AECYGHVSDI THLLEANPAA  480
LSRSHTFLES G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047035.10.0PREDICTED: cyclic dof factor 3-like
RefseqXP_011047036.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLB9I6510.0B9I651_POPTR; Uncharacterized protein
STRINGPOPTR_0013s06290.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-56cycling DOF factor 2